PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_33.182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 318aa    MW: 35396.6 Da    PI: 7.2555
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_33.182genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.5e-15247295554
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                                   ++++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+ + +el++
  evm.model.supercontig_33.182 247 RKQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLR-RQKELEN 295
                                   689**************************************9.6666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-13239294No hitNo description
SMARTSM003387.3E-13243311IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.576245290IPR004827Basic-leucine zipper domain
CDDcd147075.04E-24247301No hitNo description
SuperFamilySSF579592.75E-11247292No hitNo description
PfamPF001705.4E-12247290IPR004827Basic-leucine zipper domain
PROSITE patternPS000360250265IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGSEGGEPNL QNLATQTSLY NLTLDEVQNQ LGNLGKPLGS MNLDELLKSV CSAEVNQSTP  60
LADDNVGITY TASGSALSRQ GSLALSRDLS RKTVDEVWRD IQKSKNKNDQ ERRCQERQLT  120
FGGMTLEDFL LKAGVVSEPT HVHVLGVESV IFSQPNIPHH PHWNQYQLPS LQQQQQQQHQ  180
QDVMALVPGQ PTQHPLPVGV NPDAAYPETQ VTISPSSLMG TLSDTQAQAP GRKRVASEDV  240
AEKNVERKQK RMIKNRESAA RSRARKQAYT HELENKVSRL EEENERLRRQ KELENALPCA  300
PPPEPKYQLR RTSSAPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598745.11e-119PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_009598744.11e-119PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_016504977.11e-119PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-101AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A068VAQ21e-127A0A068VAQ2_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000185741e-118(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.16e-89ABA-responsive element binding protein 3